Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlyl endopeptidase
LigandBDBM50338518
Substrate/Competitorn/a
Meas. Tech.ChEMBL_728478
Ki>30000±n/a nM
Citation Andrews KMBeebe DABenbow JWBoyer DADoran SDHui YLiu SMcPherson RKNeagu CParker JCPiotrowski DWSchneider SRTreadway JLVanVolkenberg MAZembrowski WJ 1-((3S,4S)-4-amino-1-(4-substituted-1,3,5-triazin-2-yl) pyrrolidin-3-yl)-5,5-difluoropiperidin-2-one inhibitors of DPP-4 for the treatment of type 2 diabetes. Bioorg Med Chem Lett 21:1810-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolyl endopeptidase
Name:Prolyl endopeptidase
Synonyms:PE | PEP | POP | PREP | Post-proline cleaving enzyme | Prolyl oligopeptidase
Type:Enzyme
Mol. Mass.:80688.50
Organism:Homo sapiens (Human)
Description:P48147
Residue:710
Sequence:
MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50338518
n/a
NameBDBM50338518
Synonyms:1-((3S,4S)-4-amino-1-(4-(3,3-difluoropyrrolidin-1-yl)-1,3,5-triazin-2-yl)pyrrolidin-3-yl)-5,5-difluoropiperidin-2-one | CHEMBL1683571
TypeSmall organic molecule
Emp. Form.C16H21F4N7O
Mol. Mass.403.3779
SMILESN[C@H]1CN(C[C@@H]1N1CC(F)(F)CCC1=O)c1ncnc(n1)N1CCC(F)(F)C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: