Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM50338693
Substrate/Competitorn/a
Meas. Tech.ChEMBL_726893
IC50 130±n/a nM
Citation Nagata NMiyakawa MAmano SFuruya KYamamoto NInoguchi K Design and synthesis of tricyclic tetrahydroquinolines as a new series of nonsteroidal selective androgen receptor modulators (SARMs). Bioorg Med Chem Lett 21:1744-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:98665.51
Organism:Oryctolagus cuniculus
Description:ChEMBL_775980
Residue:930
Sequence:
MTELKAKEPRAPHVAGGAPSPTEVGSQLLGRPDPGPFQGSQTSEASSVVSAIPISLDGLL
FPRPCQGQNPPDGKTQDPPSLSDVEGAFPGVEAPEGAGDSSSRPPEKDSGLLDSVLDTLL
APSGPGQSHASPATCEAISPWCLFGPDLPEDPRAAPATKGVLAPLMSRPEDKAGDSSGTA
AAHKVLPRGLSPSRQLLLPSSGSPHWPAVKPSPQPAAVQVDEEDSSESEGTVGPLLKGQP
RALGGTAAGGGAAPVASGAAAGGVALVPKEDSRFSAPRVSLAEQDAPVAPGRSPLATSVV
DFIHVPILPLNHAFLATRTRQLLEGESYDGGAAAASPFVPQRGSPSASSTPVAGGDFPDC
TYPPDAEPKDDAFPLYGDFQPPALKIKEEEEAAEAAARSPRTYLVAGANPAAFPDFQLAA
PPPPSLPPRVPSSRPGEAAVAASPGSASVSSSSSSGSTLECILYKAEGAPPQQGPFAPLP
CKPPGAGACLLPRDGLPSTSASGAAAGAAPALYPTLGLNGLPQLGYQAAVLKEGLPQVYT
PYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQP
VGIPNESQRITFSPSQEIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGE
RQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLI
LNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQSQFEE
MRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSV
EFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50338693
n/a
NameBDBM50338693
Synonyms:2-methyl-2-((3aR,4S,9bS)-8-nitro-3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinolin-4-yl)propan-1-ol | CHEMBL1684194
TypeSmall organic molecule
Emp. Form.C16H20N2O3
Mol. Mass.288.3416
SMILESCC(C)(CO)[C@H]1Nc2ccc(cc2[C@H]2C=CC[C@@H]12)[N+]([O-])=O |r,c:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: