Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50145685
Substrate/Competitorn/a
Meas. Tech.ChEMBL_729858
IC50 3±n/a nM
Citation Xue CBChen LCao GZhang KWang AMeloni DGlenn JAnand RXia MKong LHuang TFeng HZheng CLi MGalya LZhou JShin NBaribaud FSolomon KScherle PZhao BDiamond SEmm TKeller DContel NYeleswaram SVaddi KHollis GNewton RFriedman SMetcalf B. Discovery of INCB9471, a Potent, Selective, and Orally Bioavailable CCR5 Antagonist with Potent Anti-HIV-1 Activity. ACS Med Chem Lett 1:483-487 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:CCR5/mu opioid receptor complex
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CCR5/mu opioid receptor complex | CD_antigen=CD195 | CHEMR13 | HIV-1 fusion coreceptor
Type:Enzyme
Mol. Mass.:40540.21
Organism:Homo sapiens (Human)
Description:P51681
Residue:352
Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145685
n/a
NameBDBM50145685
Synonyms:(4,6-Dimethyl-pyrimidin-5-yl)-(4-{(S)-4-[(R)-2-methoxy-1-(4-trifluoromethyl-phenyl)-ethyl]-3-methyl-piperazin-1-yl}-4-methyl-piperidin-1-yl)-methanone | CHEMBL82301
TypeSmall organic molecule
Emp. Form.C28H38F3N5O2
Mol. Mass.533.6288
SMILESCOC[C@H](N1CCN(C[C@@H]1C)C1(C)CCN(CC1)C(=O)c1c(C)ncnc1C)c1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: