| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-carbonic anhydrase 1 |
|---|
| Ligand | BDBM50339593 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_736723 (CHEMBL1695104) |
|---|
| Ki | 910±n/a nM |
|---|
| Citation |  Davis, RA; Hofmann, A; Osman, A; Hall, RA; Mühlschlegel, FA; Vullo, D; Innocenti, A; Supuran, CT; Poulsen, SA Natural product-based phenols as novel probes for mycobacterial and fungal carbonic anhydrases. J Med Chem54:1682-92 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-carbonic anhydrase 1 |
|---|
| Name: | Beta-carbonic anhydrase 1 |
|---|
| Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18186.06 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
|---|
| BDBM50339593 |
|---|
| n/a |
|---|
| Name | BDBM50339593 |
|---|
| Synonyms: | 2-amino-4-(3,4-dihydroxybenzylidene)-1H-imidazol-5(4H)-one | CHEMBL591736 | polyandrocarpamine B |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H9N3O3 |
|---|
| Mol. Mass. | 219.1968 |
|---|
| SMILES | NC1=NC(=Cc2ccc(O)c(O)c2)C(=O)N1 |w:4.4,t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
