Reaction Details |
| Report a problem with these data |
Target | Beta-carbonic anhydrase 1 |
---|
Ligand | BDBM50339597 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_736723 (CHEMBL1695104) |
---|
Ki | 12200±n/a nM |
---|
Citation | Davis, RA; Hofmann, A; Osman, A; Hall, RA; Mühlschlegel, FA; Vullo, D; Innocenti, A; Supuran, CT; Poulsen, SA Natural product-based phenols as novel probes for mycobacterial and fungal carbonic anhydrases. J Med Chem54:1682-92 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Beta-carbonic anhydrase 1 |
---|
Name: | Beta-carbonic anhydrase 1 |
Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
Type: | Enzyme |
Mol. Mass.: | 18186.06 |
Organism: | Mycobacterium tuberculosis |
Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
Residue: | 163 |
Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
BDBM50339597 |
---|
n/a |
---|
Name | BDBM50339597 |
Synonyms: | CHEMBL589354 | N-benzyl-2-(3-chloro-4-hydroxyphenyl)acetamide |
Type | Small organic molecule |
Emp. Form. | C15H14ClNO2 |
Mol. Mass. | 275.73 |
SMILES | Oc1ccc(CC(=O)NCc2ccccc2)cc1Cl |
Structure |
|