Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50340312
Substrate/Competitorn/a
Meas. Tech.ChEMBL_741484
IC50 0.3±n/a nM
Citation Trotter BWNanda KKBurgey CSPotteiger CMDeng JZGreen AIHartnett JCKett NRWu ZHenze DADella Penna KDesai RLeitl MDLemaire WWhite RBYeh SUrban MOKane SAHartman GDBilodeau MT Imidazopyridine CB2 agonists: optimization of CB2/CB1 selectivity and implications for in vivo analgesic efficacy. Bioorg Med Chem Lett 21:2354-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50340312
n/a
NameBDBM50340312
Synonyms:(2,3-dichlorophenyl)(1-((4,4-difluoropiperidin-1-yl)methyl)imidazo[1,5-a]pyridin-3-yl)methanone | CHEMBL1760932
TypeSmall organic molecule
Emp. Form.C20H17Cl2F2N3O
Mol. Mass.424.271
SMILESFC1(F)CCN(Cc2nc(C(=O)c3cccc(Cl)c3Cl)n3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: