| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50340319 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_741489 (CHEMBL1763804) |
|---|
| IC50 | 58±n/a nM |
|---|
| Citation |  Trotter, BW; Nanda, KK; Burgey, CS; Potteiger, CM; Deng, JZ; Green, AI; Hartnett, JC; Kett, NR; Wu, Z; Henze, DA; Della Penna, K; Desai, R; Leitl, MD; Lemaire, W; White, RB; Yeh, S; Urban, MO; Kane, SA; Hartman, GD; Bilodeau, MT Imidazopyridine CB2 agonists: optimization of CB2/CB1 selectivity and implications for in vivo analgesic efficacy. Bioorg Med Chem Lett21:2354-8 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50340319 |
|---|
| n/a |
|---|
| Name | BDBM50340319 |
|---|
| Synonyms: | CHEMBL1760939 | N-((1-(hydroxymethyl)cyclopentyl)methyl)-3-morpholinoimidazo[1,5-a]pyridine-1-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N4O3 |
|---|
| Mol. Mass. | 358.4347 |
|---|
| SMILES | OCC1(CNC(=O)c2nc(N3CCOCC3)n3ccccc23)CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
