Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I delta/epsilon
LigandBDBM50341342
Substrate/Competitorn/a
Meas. Tech.ChEMBL_742472
Kd>1000±n/a nM
Citation Goldstein DMSoth MGabriel TDewdney NKuglstatter AArzeno HChen JBingenheimer WDalrymple SADunn JFarrell RFrauchiger SLa Fargue JGhate MGraves BHill RJLi FLitman RLoe BMcIntosh JMcWeeney DPapp EPark JReese HFRoberts RTRotstein DSan Pablo BSarma KStahl MSung MLSuttman RTSjogren EBTan YTrejo AWelch MWeller PWong BRZecic H Discovery of 6-(2,4-difluorophenoxy)-2-[3-hydroxy-1-(2-hydroxyethyl)propylamino]-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-one (pamapimod) and 6-(2,4-difluorophenoxy)-8-methyl-2-(tetrahydro-2H-pyran-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one (R1487) as orally bioavailable and highly selective inhibitors J Med Chem 54:2255-65 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I delta/epsilon
Name:Casein kinase I delta/epsilon
Synonyms:CKI-epsilon | CKIe | CSNK1E | Casein kinase 1 epsilon (CK1Ɛ) | Casein kinase I epsilon | Casein kinase I isoform epsilon (CK1 epsilon) | Casein kinase I isoform epsilon (CK1E) | Casein kinase I isoform epsilon (CK1epsilon)
Type:Protein
Mol. Mass.:47340.25
Organism:Homo sapiens (Human)
Description:P49674
Residue:416
Sequence:
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50341342
n/a
NameBDBM50341342
Synonyms:6-(2,4-difluorophenoxy)-8-methyl-2-(tetrahydro-2H-pyran-4-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one | CHEMBL1230122
TypeSmall organic molecule
Emp. Form.C19H18F2N4O3
Mol. Mass.388.368
SMILESCn1c2nc(NC3CCOCC3)ncc2cc(Oc2ccc(F)cc2F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: