Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 3
LigandBDBM50341519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_742015
Ki>2000±n/a nM
Citation Charrier JDMiller AKay DPBrenchley GTwin HCCollier PNRamaya SKeily SBDurrant SJKnegtel RMTanner AJBrown KCurnock APJimenez JM Discovery and structure-activity relationship of 3-aminopyrid-2-ones as potent and selective interleukin-2 inducible T-cell kinase (Itk) inhibitors. J Med Chem 54:2341-50 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 3
Name:MAP kinase ERK1
Synonyms:ERK1 | ERK1/ERK2 | Extracellular signal-regulated kinase 1 | Extracellular signal-regulated kinase 1 (ERK1) | MAP kinase ERK1 | Mitogen-activated protein kinase
Type:Protein
Mol. Mass.:43136.58
Organism:Homo sapiens (Human)
Description:curated by PDB 4QTB
Residue:379
Sequence:
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50341519
n/a
NameBDBM50341519
Synonyms:(S)-3-(4-(2-(pyrrolidin-1-ylmethyl)pyrrolidin-1-yl)benzoylamino)-5-(6-(methylamino)pyrazin-2-yl)-(1H)-pyridin-2-one | CHEMBL1765781
TypeSmall organic molecule
Emp. Form.C26H31N7O2
Mol. Mass.473.57
SMILESCNc1cncc(n1)-c1c[nH]c(=O)c(NC(=O)c2ccc(cc2)N2CCC[C@H]2CN2CCCC2)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: