| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50341606 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_742836 (CHEMBL1769839) |
|---|
| Ki | 0.776±n/a nM |
|---|
| Citation |  Poli, D; Catarzi, D; Colotta, V; Varano, F; Filacchioni, G; Daniele, S; Trincavelli, L; Martini, C; Paoletta, S; Moro, S The identification of the 2-phenylphthalazin-1(2H)-one scaffold as a new decorable core skeleton for the design of potent and selective human A3 adenosine receptor antagonists. J Med Chem54:2102-13 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50341606 |
|---|
| n/a |
|---|
| Name | BDBM50341606 |
|---|
| Synonyms: | 1-(2,5-dimethoxyphenyl)-3-(4-oxo-3-phenyl-3,4-dihydrophthalazin-1-yl)urea | CHEMBL1766358 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H20N4O4 |
|---|
| Mol. Mass. | 416.4293 |
|---|
| SMILES | COc1ccc(OC)c(NC(=O)Nc2nn(-c3ccccc3)c(=O)c3ccccc23)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
