Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase, JNK
LigandBDBM50342301
Substrate/Competitorn/a
Meas. Tech.ChEMBL_742811
Kd 1.1E3±n/a nM
Citation De SKBarile EChen VStebbins JLCellitti JFMachleidt TCarlson CBYang LDahl RPellecchia M Design, synthesis, and structure-activity relationship studies of thiophene-3-carboxamide derivatives as dual inhibitors of the c-Jun N-terminal kinase. Bioorg Med Chem 19:2582-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
c-Jun N-terminal kinase, JNK
Name:c-Jun N-terminal kinase, JNK
Synonyms:JNK-46 | JNK1 | JNK1-alpha-1 | Mitogen-Activated Protein Kinase 8 (JNK1) | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48297.57
Organism:Homo sapiens (Human)
Description:JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:427
Sequence:
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342301
n/a
NameBDBM50342301
Synonyms:2-(2-(benzo[b]thiophen-3-yl)acetamido)thiophene-3-carboxamide | CHEMBL1767254
TypeSmall organic molecule
Emp. Form.C15H12N2O2S2
Mol. Mass.316.398
SMILESNC(=O)c1ccsc1NC(=O)Cc1csc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: