| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2C |
|---|
| Ligand | BDBM50161646 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_744737 (CHEMBL1772758) |
|---|
| EC50 | 9±n/a nM |
|---|
| Citation |  Andrews, MD; Fish, PV; Blagg, J; Brabham, TK; Brennan, PE; Bridgeland, A; Brown, AD; Bungay, PJ; Conlon, KM; Edmunds, NJ; af Forselles, K; Gibbons, CP; Green, MP; Hanton, G; Holbrook, M; Jessiman, AS; McIntosh, K; McMurray, G; Nichols, CL; Root, JA; Storer, RI; Sutton, MR; Ward, RV; Westbrook, D; Whitlock, GA Pyrimido[4,5-d]azepines as potent and selective 5-HT2C receptor agonists: design, synthesis, and evaluation of PF-3246799 as a treatment for urinary incontinence. Bioorg Med Chem Lett21:2715-20 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2C |
|---|
| Name: | 5-hydroxytryptamine receptor 2C |
|---|
| Synonyms: | 5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 51836.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28335 |
|---|
| Residue: | 458 |
|---|
| Sequence: | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
|---|
| BDBM50161646 |
|---|
| n/a |
|---|
| Name | BDBM50161646 |
|---|
| Synonyms: | (1R)-8-chloro-2,3,4,5-tetrahydro-1-methyl-1H-3-benzazepine | (R)-8-Chloro-1-methyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine | CHEMBL360328 | LORCASERIN |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14ClN |
|---|
| Mol. Mass. | 195.689 |
|---|
| SMILES | C[C@H]1CNCCc2ccc(Cl)cc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
