| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 3A |
|---|
| Ligand | BDBM50342538 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_744884 (CHEMBL1772905) |
|---|
| IC50 | 2300±n/a nM |
|---|
| Citation |  Andrews, MD; Fish, PV; Blagg, J; Brabham, TK; Brennan, PE; Bridgeland, A; Brown, AD; Bungay, PJ; Conlon, KM; Edmunds, NJ; af Forselles, K; Gibbons, CP; Green, MP; Hanton, G; Holbrook, M; Jessiman, AS; McIntosh, K; McMurray, G; Nichols, CL; Root, JA; Storer, RI; Sutton, MR; Ward, RV; Westbrook, D; Whitlock, GA Pyrimido[4,5-d]azepines as potent and selective 5-HT2C receptor agonists: design, synthesis, and evaluation of PF-3246799 as a treatment for urinary incontinence. Bioorg Med Chem Lett21:2715-20 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 3A |
|---|
| Name: | 5-hydroxytryptamine receptor 3A |
|---|
| Synonyms: | 5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | 5HT3A_HUMAN | 5HT3R | HTR3 | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 55283.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46098 |
|---|
| Residue: | 478 |
|---|
| Sequence: | MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
|
|
|
|---|
| BDBM50342538 |
|---|
| n/a |
|---|
| Name | BDBM50342538 |
|---|
| Synonyms: | 2-benzyl-6,7,8,9-tetrahydro-5H-pyrimido[5,4-d]azepine | CHEMBL1770373 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H17N3 |
|---|
| Mol. Mass. | 239.3156 |
|---|
| SMILES | C(c1ccccc1)c1ncc2CCNCCc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
