Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT2
LigandBDBM50342704
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744161
Ki 190±n/a nM
Citation Ortega RHübner HGmeiner PMasaguer CF Aromatic ring functionalization of benzolactam derivatives: new potent dopamine D3 receptor ligands. Bioorg Med Chem Lett 21:2670-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-HT2
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52679.13
Organism:PIG
Description:5-HT2 0 0::P50129
Residue:470
Sequence:
MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342704
n/a
NameBDBM50342704
Synonyms:3,4-Dihydro-2-[4-(4-(2-methoxyphenyl)piperazin-1-yl)butyl]-6-(2-thienyl)isoquinolin-1(2H)-one | CHEMBL1771110
TypeSmall organic molecule
Emp. Form.C28H33N3O2S
Mol. Mass.475.646
SMILESCOc1ccccc1N1CCN(CCCCN2CCc3cc(ccc3C2=O)-c2cccs2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: