Reaction Details |
| Report a problem with these data |
Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Ligand | BDBM9019 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_744409 (CHEMBL1772363) |
---|
IC50 | 65±n/a nM |
---|
Citation | Leclerc, V; Ettaoussi, M; Rami, M; Farce, A; Boutin, JA; Delagrange, P; Caignard, DH; Renard, P; Berthelot, P; Yous, S Design and synthesis of naphthalenic derivatives as new ligands at the melatonin binding site MT3. Eur J Med Chem46:1622-9 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Type: | Protein |
Mol. Mass.: | 25917.25 |
Organism: | Homo sapiens (Human) |
Description: | P16083 |
Residue: | 231 |
Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
BDBM9019 |
---|
n/a |
---|
Name | BDBM9019 |
Synonyms: | CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide |
Type | Small organic molecule |
Emp. Form. | C13H16N2O2 |
Mol. Mass. | 232.2783 |
SMILES | COc1ccc2[nH]cc(CCNC(C)=O)c2c1 |
Structure |
|