| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Ligand | BDBM29568 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_744409 (CHEMBL1772363) |
|---|
| IC50 | 7.8±n/a nM |
|---|
| Citation |  Leclerc, V; Ettaoussi, M; Rami, M; Farce, A; Boutin, JA; Delagrange, P; Caignard, DH; Renard, P; Berthelot, P; Yous, S Design and synthesis of naphthalenic derivatives as new ligands at the melatonin binding site MT3. Eur J Med Chem46:1622-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25917.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P16083 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
|---|
| BDBM29568 |
|---|
| n/a |
|---|
| Name | BDBM29568 |
|---|
| Synonyms: | CHEMBL2 | PRAZOSIN | PRAZOSIN HYDROCHLORIDE | [3H]-Furazosin | [3H]-Minipress | [3H]-Pratsiol | [3H]-Prazosin |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C19H21N5O4 |
|---|
| Mol. Mass. | 383.4011 |
|---|
| SMILES | COc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
