Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM50112208
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744409
Ki 0.300000±n/a nM
Citation Leclerc VEttaoussi MRami MFarce ABoutin JADelagrange PCaignard DHRenard PBerthelot PYous S Design and synthesis of naphthalenic derivatives as new ligands at the melatonin binding site MT3. Eur J Med Chem 46:1622-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112208
n/a
NameBDBM50112208
Synonyms:CHEMBL300728 | N-(2-(2-iodo-5-methoxy-1-methyl-4-nitro-1H-indol-3-yl)ethyl)acetamide | N-[2-(2-Iodo-5-methoxy-1-methyl-4-nitro-1H-indol-3-yl)-ethyl]-acetamide
TypeSmall organic molecule
Emp. Form.C14H16IN3O4
Mol. Mass.417.199
SMILESCOc1ccc2n(C)c(I)c(CCNC(C)=O)c2c1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: