Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow affinity sodium-glucose cotransporter
LigandBDBM50313368
Substrate/Competitorn/a
Meas. Tech.ChEMBL_745217
IC50 6.98±n/a nM
Citation Mascitti VMaurer TSRobinson RPBian JBoustany-Kari CMBrandt TCollman BMKalgutkar ASKlenotic MKLeininger MTLowe AMaguire RJMasterson VMMiao ZMukaiyama EPatel JDPettersen JCPréville CSamas BShe LSobol ZSteppan CMStevens BDThuma BATugnait MZeng DZhu T Discovery of a clinical candidate from the structurally unique dioxa-bicyclo[3.2.1]octane class of sodium-dependent glucose cotransporter 2 inhibitors. J Med Chem 54:2952-60 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low affinity sodium-glucose cotransporter
Name:Low affinity sodium-glucose cotransporter
Synonyms:Na(+)/glucose cotransporter 3 | Sodium/glucose cotransporter 3 | Solute carrier family 5 member 4
Type:PROTEIN
Mol. Mass.:72452.26
Organism:Homo sapiens (Human)
Description:ChEMBL_764617
Residue:659
Sequence:
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50313368
n/a
NameBDBM50313368
Synonyms:(6S,7R,8R,9S)-6-(3-(4-methoxybenzyl)-4-methylphenyl)-2,5-dioxaspiro[3.5]nonane-7,8,9-triol | CHEMBL1090058
TypeSmall organic molecule
Emp. Form.C22H26O6
Mol. Mass.386.4382
SMILESCOc1ccc(Cc2cc(ccc2C)[C@@H]2OC3(COC3)[C@@H](O)[C@H](O)[C@H]2O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: