Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK4
LigandBDBM50342900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744201
IC50 15±n/a nM
Citation Rosenthal ASTanega CShen MMott BTBougie JMNguyen DTMisteli TAuld DSMaloney DJThomas CJ Potent and selective small molecule inhibitors of specific isoforms of Cdc2-like kinases (Clk) and dual specificity tyrosine-phosphorylation-regulated kinases (Dyrk). Bioorg Med Chem Lett 21:3152-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK4
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 4 | CLK4
Type:Serine/threonine-protein kinase
Mol. Mass.:57522.53
Organism:Homo sapiens (Human)
Description:gi_10190706
Residue:481
Sequence:
MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKK
K
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342900
n/a
NameBDBM50342900
Synonyms:6-(benzo[d][1,3]dioxol-5-yl)-N-((5-methylfuran-2-yl)methyl)quinazolin-4-amine | CHEMBL1473127
TypeSmall organic molecule
Emp. Form.C21H17N3O3
Mol. Mass.359.378
SMILESCc1ccc(CNc2ncnc3ccc(cc23)-c2ccc3OCOc3c2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: