Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-regulated kinases 1B
LigandBDBM50342916
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744230
IC50 25±n/a nM
Citation Rosenthal ASTanega CShen MMott BTBougie JMNguyen DTMisteli TAuld DSMaloney DJThomas CJ Potent and selective small molecule inhibitors of specific isoforms of Cdc2-like kinases (Clk) and dual specificity tyrosine-phosphorylation-regulated kinases (Dyrk). Bioorg Med Chem Lett 21:3152-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-regulated kinases 1B
Name:Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms:DYRK1B | Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Type:Enzyme
Mol. Mass.:69222.24
Organism:Homo sapiens (Human)
Description:Q9Y463
Residue:629
Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342916
n/a
NameBDBM50342916
Synonyms:6-(benzo[d][1,3]dioxol-5-yl)-N-methyl-N-((2-methylthiazol-4-yl)methyl)quinazolin-4-amine | CHEMBL1474834
TypeSmall organic molecule
Emp. Form.C21H18N4O2S
Mol. Mass.390.458
SMILESCN(Cc1csc(C)n1)c1ncnc2ccc(cc12)-c1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: