Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target72 kDa type IV collagenase
LigandBDBM50343084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744950
Ki 410±n/a nM
Citation Barta TEBecker DPBedell LJEaston AMHockerman SLKiefer JMunie GEMathis KJLi MHRico JGVillamil CIWilliams JM MMP-13 selectivea-sulfone hydroxamates: a survey of P1' heterocyclic amide isosteres. Bioorg Med Chem Lett 21:2820-2 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
72 kDa type IV collagenase
Name:72 kDa type IV collagenase
Synonyms:72 kDa gelatinase | 72 kDa type IV collagenase precursor | Gelatinase A | Gelatinase A (MMP-2) | Matrix metalloproteinase-2 | Matrix metalloproteinase-2 (MMP 2) | Matrix metalloproteinase-2 (MMP2) | Matrix metalloproteinases 2 (MMP-2) | TBE-1
Type:Enzyme
Mol. Mass.:73870.36
Organism:Homo sapiens (Human)
Description:
Residue:660
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50343084
n/a
NameBDBM50343084
Synonyms:CHEMBL1771219 | N-hydroxy-4-(4-(3-(3-(4-(trifluoromethoxy)phenyl)-1,2,4-oxadiazol-5-yl)propoxy)phenylsulfonyl)tetrahydro-2H-pyran-4-carboxamide
TypeSmall organic molecule
Emp. Form.C24H24F3N3O8S
Mol. Mass.571.523
SMILESONC(=O)C1(CCOCC1)S(=O)(=O)c1ccc(OCCCc2nc(no2)-c2ccc(OC(F)(F)F)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: