| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 14 |
|---|
| Ligand | BDBM50343102 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_745158 (CHEMBL1772337) |
|---|
| IC50 | 1900±n/a nM |
|---|
| Citation |  Guay, D; Beaulieu, C; Belley, M; Crane, SN; DeLuca, J; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Chan, CC; Xu, L; Gordon, R; Li, L; Mamane, Y; Morin, N; Mancini, J; Thérien, M; Tranmer, G; Truong, VL; Wang, Z; Black, WC Synthesis and SAR of pyrimidine-based, non-nucleotide P2Y14 receptor antagonists. Bioorg Med Chem Lett21:2832-5 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 14 |
|---|
| Name: | P2Y purinoceptor 14 |
|---|
| Synonyms: | G-protein coupled receptor 105 | Gpr105 | P2Y14 | P2Y14_MOUSE | P2ry14 | UDP-glucose receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38883.93 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_745158 |
|---|
| Residue: | 338 |
|---|
| Sequence: | MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
|
|
|
|---|
| BDBM50343102 |
|---|
| n/a |
|---|
| Name | BDBM50343102 |
|---|
| Synonyms: | 2-(pyridin-3-yl)-N-m-tolyl-4-o-tolyl-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxamide | CHEMBL1771237 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H25N5O |
|---|
| Mol. Mass. | 435.5203 |
|---|
| SMILES | Cc1cccc(NC(=O)N2CCc3nc(nc(c3C2)-c2ccccc2C)-c2cccnc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
