Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetX-linked inhibitor of apoptosis protein (XIAP)
LigandBDBM50343515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_746782
Ki 47±n/a nM
Citation Sun HLiu LLu JBai LLi XNikolovska-Coleska ZMcEachern DYang CYQiu SYi HSun DWang S Potent bivalent Smac mimetics: effect of the linker on binding to inhibitor of apoptosis proteins (IAPs) and anticancer activity. J Med Chem 54:3306-18 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
X-linked inhibitor of apoptosis protein (XIAP)
Name:X-linked inhibitor of apoptosis protein (XIAP)
Synonyms:E3 ubiquitin-protein ligase XIAP | Inhibitor of apoptosis protein 3 | Inhibitor of apoptosis protein 3 (XIAP) | X-linked inhibitor of apoptosis
Type:Protein
Mol. Mass.:56685.27
Organism:Homo sapiens (Human)
Description:P98170
Residue:497
Sequence:
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50343515
n/a
NameBDBM50343515
Synonyms:(3S,6S,1'aS)-6-((S)-2-(Methylamino)propanamido)-N-((1-(4-(4-(4-(4-((S)-((3S,6S,1'aS)-6-((S)-2-(methylamino)propanamido)-5-oxodecahydropyrrolo[1,2-a]azocine-3-carboxamido)(phenyl)methyl)-1H-1,2,3-triazol-1-yl)butyl)-1H-1,2,3-triazol-1-yl)butyl)1H-1,2,3-triazol-4-yl)-(phenyl)methyl)-5-oxodecahydropyrrolo[1,2-a]azocine-3-carboxamide | CHEMBL1774161
TypeSmall organic molecule
Emp. Form.C58H81N17O6
Mol. Mass.1112.374
SMILESCN[C@@H](C)C(=O)N[C@H]1CCCC[C@H]2CC[C@H](N2C1=O)C(=O)N[C@H](c1cn(CCCCc2cn(CCCCn3cc(nn3)[C@@H](NC(=O)[C@@H]3CC[C@@H]4CCCC[C@H](NC(=O)[C@H](C)NC)C(=O)N34)c3ccccc3)nn2)nn1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: