Reaction Details |
| Report a problem with these data |
Target | Matrix protein 2 [1-96] |
---|
Ligand | BDBM50343546 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_747076 (CHEMBL1777442) |
---|
IC50 | 7200±n/a nM |
---|
Citation | Duque, MD; Ma, C; Torres, E; Wang, J; Naesens, L; Juárez-Jiménez, J; Camps, P; Luque, FJ; DeGrado, WF; Lamb, RA; Pinto, LH; Vázquez, S Exploring the size limit of templates for inhibitors of the M2 ion channel of influenza A virus. J Med Chem54:2646-57 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Matrix protein 2 [1-96] |
---|
Name: | Matrix protein 2 [1-96] |
Synonyms: | M | M2_I72A2 | Matrix protein 2 |
Type: | PROTEIN |
Mol. Mass.: | 11051.96 |
Organism: | Influenza A virus |
Description: | ChEMBL_1453980 |
Residue: | 96 |
Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL
|
|
|
BDBM50343546 |
---|
n/a |
---|
Name | BDBM50343546 |
Synonyms: | C-(2,5-Dimethyl-hexahydro-2,5-cyclo-pentalen-3a-yl)-methylamine | CHEMBL508777 | [(3,7-Dimethyltricyclo[3.3.0.03,7]oct-1-yl)methyl]amine |
Type | Small organic molecule |
Emp. Form. | C11H19N |
Mol. Mass. | 165.2753 |
SMILES | CC12CC3CC1(C)CC3(CN)C2 |TLB:9:8:5.4:2,THB:7:5:2:11.8,7:8:5.4:2| |
Structure |
|