Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50343620 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_746382 (CHEMBL1776341) |
---|
Ki | 0.8±n/a nM |
---|
Citation | Li, ZJ; Ren, HY; Cui, MC; Deuther-Conrad, W; Tang, RK; Steinbach, J; Brust, P; Liu, BL; Jia, HM Synthesis and biological evaluation of novel 4-benzylpiperazine ligands for sigma-1 receptor imaging. Bioorg Med Chem19:2911-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50343620 |
---|
n/a |
---|
Name | BDBM50343620 |
Synonyms: | 1-(1,3-Benzodioxol-5-ylmethyl)-4-(4-iodobenzyl)piperazine | CHEMBL1774730 |
Type | Small organic molecule |
Emp. Form. | C19H21IN2O2 |
Mol. Mass. | 436.2867 |
SMILES | Ic1ccc(CN2CCN(Cc3ccc4OCOc4c3)CC2)cc1 |
Structure |
|