Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel beta subunit Mink
LigandBDBM50343722
Substrate/Competitorn/a
Meas. Tech.ChEMBL_746072
IC50>10000±n/a nM
Citation Wang LHubert JALee SJPan JQian SReitman MLStrack AMWeingarth DTMacNeil DJWeber AEEdmondson SD Discovery of pyrimidine carboxamides as potent and selective CCK1 receptor agonists. Bioorg Med Chem Lett 21:2911-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel beta subunit Mink
Name:Voltage-gated potassium channel beta subunit Mink
Synonyms:Delayed rectifier potassium channel subunit IsK | IKs producing slow voltage-gated potassium channel subunit beta Mink | KCNQ1(Kv7.1)/KCNE1(MinK) | Minimal potassium channel | Voltage-gated potassium channel, IKs
Type:PROTEIN
Mol. Mass.:14676.11
Organism:Homo sapiens (Human)
Description:ChEMBL_1456351
Residue:129
Sequence:
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLG
IMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNT
HLPETKPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50343722
n/a
NameBDBM50343722
Synonyms:3-(4-(5-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-4-(2-fluoro-4-methylphenyl)pyrimidine-2-carbonyl)piperazin-1-yl)-1-naphthoic acid | CHEMBL1773877
TypeSmall organic molecule
Emp. Form.C35H29FN4O5
Mol. Mass.604.627
SMILESCc1ccc(c(F)c1)-c1nc(ncc1-c1ccc2OCCOc2c1)C(=O)N1CCN(CC1)c1cc(C(O)=O)c2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: