| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 14 |
|---|
| Ligand | BDBM50343878 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_747401 (CHEMBL1776795) |
|---|
| IC50 | 54±n/a nM |
|---|
| Citation |  Gauthier, JY; Belley, M; Deschênes, D; Fournier, JF; Gagné, S; Gareau, Y; Hamel, M; Hénault, M; Hyjazie, H; Kargman, S; Lavallée, G; Levesque, JF; Li, L; Mamane, Y; Mancini, J; Morin, N; Mulrooney, E; Robichaud, J; Thérien, M; Tranmer, G; Wang, Z; Wu, J; Black, WC The identification of 4,7-disubstituted naphthoic acid derivatives as UDP-competitive antagonists of P2Y14. Bioorg Med Chem Lett21:2836-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 14 |
|---|
| Name: | P2Y purinoceptor 14 |
|---|
| Synonyms: | G-protein coupled receptor 105 | Gpr105 | P2Y14 | P2Y14_MOUSE | P2ry14 | UDP-glucose receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38883.93 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_745158 |
|---|
| Residue: | 338 |
|---|
| Sequence: | MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
|
|
|
|---|
| BDBM50343878 |
|---|
| n/a |
|---|
| Name | BDBM50343878 |
|---|
| Synonyms: | 4-(thiophen-3-yl)-7-(4-(trifluoromethoxy)phenyl)-2-naphthoic acid | CHEMBL1774893 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H13F3O3S |
|---|
| Mol. Mass. | 414.397 |
|---|
| SMILES | OC(=O)c1cc(-c2ccsc2)c2ccc(cc2c1)-c1ccc(OC(F)(F)F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
