Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1B1
LigandBDBM7459
Substrate/Competitorn/a
Meas. Tech.ChEMBL_748493
Ki 56±n/a nM
Citation Androutsopoulos VPPapakyriakou AVourloumis DSpandidos DA Comparative CYP1A1 and CYP1B1 substrate and inhibitor profile of dietary flavonoids. Bioorg Med Chem 19:2842-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1B1
Name:Cytochrome P450 1B1
Synonyms:CYPIB1 | Cytochrome P450 1B1 (CYP1B1)
Type:PROTEIN
Mol. Mass.:60861.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1474523
Residue:543
Sequence:
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7459
n/a
NameBDBM7459
Synonyms:2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | cid_5280445 | luteolin
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: