Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50344107
Substrate/Competitorn/a
Meas. Tech.ChEMBL_748611
Ki 5.1±n/a nM
Citation Chen JJNguyen TD'Amico DCQian WHuman JAya TBiswas KFotsch CHan NLiu QNishimura NPeterkin TAYang KZhu JRiahi BBHungate RWAndersen NGColyer JTFaul MMKamassah AWang JJona JKumar GJohnson EAskew BC 3-Oxo-2-piperazinyl acetamides as potent bradykinin B1 receptor antagonists for the treatment of pain and inflammation. Bioorg Med Chem Lett 21:3384-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50344107
n/a
NameBDBM50344107
Synonyms:2-(5-oxo-1-tosylpiperazin-2-yl)-N-((R)-6-(piperidin-1-ylmethyl)-1,2,3,4-tetrahydronaphthalen-1-yl)acetamide | CHEMBL1777965
TypeSmall organic molecule
Emp. Form.C29H38N4O4S
Mol. Mass.538.701
SMILESCc1ccc(cc1)S(=O)(=O)N1CC(=O)NCC1CC(=O)N[C@@H]1CCCc2cc(CN3CCCCC3)ccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: