| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Natriuretic peptides A |
|---|
| Ligand | BDBM50344188 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_748204 (CHEMBL1780285) |
|---|
| IC50 | 130±n/a nM |
|---|
| Citation |  Glossop, MS; Bazin, RJ; Dack, KN; Fox, DN; MacDonald, GA; Mills, M; Owen, DR; Phillips, C; Reeves, KA; Ringer, TJ; Strang, RS; Watson, CA Synthesis and evaluation of heteroarylalanine diacids as potent and selective neutral endopeptidase inhibitors. Bioorg Med Chem Lett21:3404-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Natriuretic peptides A |
|---|
| Name: | Natriuretic peptides A |
|---|
| Synonyms: | ANF | ANF_HUMAN | ANP | Atrial natriuretic factor | Atrial natriuretic peptide | CDD-ANF | CDP | Cardiodilatin-related peptide | NPPA | Natriuretic peptides A | PND | Prepronatriodilatin |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16393.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_748204 |
|---|
| Residue: | 151 |
|---|
| Sequence: | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
|
|
|
|---|
| BDBM50344188 |
|---|
| n/a |
|---|
| Name | BDBM50344188 |
|---|
| Synonyms: | (S)-2-(1-((S)-1-carboxy-2-(4-ethyloxazol-2-yl)ethylcarbamoyl)cyclopentylamino)pentanoic acid | CHEMBL1778527 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H29N3O6 |
|---|
| Mol. Mass. | 395.4501 |
|---|
| SMILES | CCC[C@H](NC1(CCCC1)C(=O)N[C@@H](Cc1nc(CC)co1)C(O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
