Reaction Details |
| Report a problem with these data |
Target | Natriuretic peptides A |
---|
Ligand | BDBM50344193 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_748204 (CHEMBL1780285) |
---|
IC50 | 270±n/a nM |
---|
Citation | Glossop, MS; Bazin, RJ; Dack, KN; Fox, DN; MacDonald, GA; Mills, M; Owen, DR; Phillips, C; Reeves, KA; Ringer, TJ; Strang, RS; Watson, CA Synthesis and evaluation of heteroarylalanine diacids as potent and selective neutral endopeptidase inhibitors. Bioorg Med Chem Lett21:3404-6 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Natriuretic peptides A |
---|
Name: | Natriuretic peptides A |
Synonyms: | ANF | ANF_HUMAN | ANP | Atrial natriuretic factor | Atrial natriuretic peptide | CDD-ANF | CDP | Cardiodilatin-related peptide | NPPA | Natriuretic peptides A | PND | Prepronatriodilatin |
Type: | PROTEIN |
Mol. Mass.: | 16393.93 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_748204 |
Residue: | 151 |
Sequence: | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
|
|
|
BDBM50344193 |
---|
n/a |
---|
Name | BDBM50344193 |
Synonyms: | (S)-2-(1-((S)-1-carboxy-2-(5-phenyloxazol-2-yl)ethylcarbamoyl)cyclopentylamino)-4-methoxybutanoic acid | CHEMBL1778532 |
Type | Small organic molecule |
Emp. Form. | C23H29N3O7 |
Mol. Mass. | 459.4923 |
SMILES | COCC[C@H](NC1(CCCC1)C(=O)N[C@@H](Cc1ncc(o1)-c1ccccc1)C(O)=O)C(O)=O |r| |
Structure |
|