Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50108653
Substrate/Competitorn/a
Meas. Tech.ChEMBL_748646
Ki 1.29±n/a nM
Citation Rack EFröhlich RSchepmann DWünsch B Design, synthesis and pharmacological evaluation of spirocyclics(1) receptor ligands with exocyclic amino moiety (increased distance 1). Bioorg Med Chem 19:3141-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma-1 receptor
Synonyms:OPRS1 | SIGMAR1 | Sigma 1-type opioid receptor | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein
Type:Protein
Mol. Mass.:25307.17
Organism:Cavia porcellus (Guinea pig)
Description:Q60492
Residue:223
Sequence:
MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50108653
n/a
NameBDBM50108653
Synonyms:1'-benzyl-3-methoxyspiro[3,4-dihydro-1H-isochromene-1,4'-(hexahydropyridine)] | 1'-benzyl-3-methoxyspiro[isochroman-1,4'-piperidine] | CHEMBL141209
TypeSmall organic molecule
Emp. Form.C21H25NO2
Mol. Mass.323.4287
SMILESCOC1Cc2ccccc2C2(CCN(Cc3ccccc3)CC2)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: