Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 4
LigandBDBM50344556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_748115
Ki 46±n/a nM
Citation Mincione FBenedini FBiondi SCecchi ATemperini CFormicola GPacileo IScozzafava AMasini ESupuran CT Synthesis and crystallographic analysis of new sulfonamides incorporating NO-donating moieties with potent antiglaucoma action. Bioorg Med Chem Lett 21:3216-21 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 4
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:Enzyme
Mol. Mass.:35037.98
Organism:Homo sapiens (Human)
Description:P22748
Residue:312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50344556
n/a
NameBDBM50344556
Synonyms:4-(nitrooxy)butyl 4-(N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)sulfamoyl)benzoate | CHEMBL1778435
TypeSmall organic molecule
Emp. Form.C13H15N5O9S3
Mol. Mass.481.481
SMILESNS(=O)(=O)c1nnc(NS(=O)(=O)c2ccc(cc2)C(=O)OCCCCO[N+]([O-])=O)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: