| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50170660 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_748962 (CHEMBL1781410) |
|---|
| Ki | 1.03±n/a nM |
|---|
| Citation |  Banister, SD; Moussa, IA; Jorgensen, WT; Chua, SW; Kassiou, M Molecular hybridization of 4-azahexacyclo[5.4.1.0(2,6).0(3,10).0(5,9).0(8,11)]dodecane-3-ol with sigma (s) receptor ligands modulates off-target activity and subtype selectivity. Bioorg Med Chem Lett21:3622-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50170660 |
|---|
| n/a |
|---|
| Name | BDBM50170660 |
|---|
| Synonyms: | CHEMBL190883 | CHEMBL521582 | N,N-dipropyl-2-[4-methoxy-3-(2-phenylethoxy)phenyl]ethylamine | N-(4-methoxy-3-phenethoxyphenethyl)-N-propylpropan-1-amine | NE-100 | [2-(4-Methoxy-3-phenethyloxy-phenyl)-ethyl]-dipropyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H33NO2 |
|---|
| Mol. Mass. | 355.5136 |
|---|
| SMILES | CCCN(CCC)CCc1ccc(OC)c(OCCc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
