Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-Phosphate Receptor 4
LigandBDBM50344798
Substrate/Competitorn/a
Meas. Tech.ChEMBL_749238
IC50 34±n/a nM
Citation Guerrero MUrbano MVelaparthi SZhao JSchaeffer MTBrown SRosen HRoberts E Discovery, design and synthesis of the first reported potent and selective sphingosine-1-phosphate 4 (S1P4) receptor antagonists. Bioorg Med Chem Lett 21:3632-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-Phosphate Receptor 4
Name:Sphingosine 1-phosphate receptor
Synonyms:EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41647.39
Organism:Homo sapiens (Human)
Description:n/a
Residue:384
Sequence:
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50344798
n/a
NameBDBM50344798
Synonyms:4-(5-(2,5-dichlorophenyl)furan-2-carboxamido)-3,5-dimethylbenzyl acetate | CHEMBL1779733
TypeSmall organic molecule
Emp. Form.C22H19Cl2NO4
Mol. Mass.432.297
SMILESCC(=O)OCc1cc(C)c(NC(=O)c2ccc(o2)-c2cc(Cl)ccc2Cl)c(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: