Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50344996 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_749090 (CHEMBL1780687) |
---|
IC50 | 0.200000±n/a nM |
---|
Citation | Luker, T; Bonnert, R; Schmidt, J; Sargent, C; Paine, SW; Thom, S; Pairaudeau, G; Patel, A; Mohammed, R; Akam, E; Dougall, I; Davis, AM; Abbott, P; Brough, S; Millichip, I; McInally, T Switching between agonists and antagonists at CRTh2 in a series of highly potent and selective biaryl phenoxyacetic acids. Bioorg Med Chem Lett21:3616-21 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50344996 |
---|
n/a |
---|
Name | BDBM50344996 |
Synonyms: | 2-(5'-cyano-2'-fluoro-5-(trifluoromethyl)biphenyl-2-yloxy)acetic acid | CHEMBL1778635 |
Type | Small organic molecule |
Emp. Form. | C16H9F4NO3 |
Mol. Mass. | 339.2412 |
SMILES | OC(=O)COc1ccc(cc1-c1cc(ccc1F)C#N)C(F)(F)F |
Structure |
|