| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM50344974 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_749090 (CHEMBL1780687) |
|---|
| IC50 | 0.600000±n/a nM |
|---|
| Citation |  Luker, T; Bonnert, R; Schmidt, J; Sargent, C; Paine, SW; Thom, S; Pairaudeau, G; Patel, A; Mohammed, R; Akam, E; Dougall, I; Davis, AM; Abbott, P; Brough, S; Millichip, I; McInally, T Switching between agonists and antagonists at CRTh2 in a series of highly potent and selective biaryl phenoxyacetic acids. Bioorg Med Chem Lett21:3616-21 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM50344974 |
|---|
| n/a |
|---|
| Name | BDBM50344974 |
|---|
| Synonyms: | (R)-2-(3'-cyano-5-(trifluoromethyl)biphenyl-2-yloxy)propanoic acid | CHEMBL1778656 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H12F3NO3 |
|---|
| Mol. Mass. | 335.2773 |
|---|
| SMILES | C[C@@H](Oc1ccc(cc1-c1cccc(c1)C#N)C(F)(F)F)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
