Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1b receptor
LigandBDBM50345130
Substrate/Competitorn/a
Meas. Tech.ChEMBL_748738
Ki 0.08±n/a nM
Citation Oost TBackfisch GBhowmik Svan Gaalen MMGeneste HHornberger WLubisch WNetz AUnger LWernet W Potent and selective oxindole-based vasopressin 1b receptor antagonists with improved pharmacokinetic properties. Bioorg Med Chem Lett 21:3828-31 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1b receptor
Name:Vasopressin V1b receptor
Synonyms:AVPR V1b | AVPR V3 | Antidiuretic hormone receptor 1b | V1bR | VASOPRESSIN V1B | Vasopressin V3 | Vasopressin V3 receptor
Type:Enzyme
Mol. Mass.:46985.01
Organism:Homo sapiens (Human)
Description:P47901
Residue:424
Sequence:
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345130
n/a
NameBDBM50345130
Synonyms:(S)-1-((R)-5-chloro-3-(2-methoxy-4-(pyrrolidin-1-ylmethyl)phenyl)-1-(4-methoxyphenylsulfonyl)-2-oxoindolin-3-yl)-N,N-dimethylpyrrolidine-2-carboxamide | CHEMBL1779406
TypeSmall organic molecule
Emp. Form.C34H39ClN4O6S
Mol. Mass.667.215
SMILESCOc1ccc(cc1)S(=O)(=O)N1C(=O)[C@@](N2CCC[C@H]2C(=O)N(C)C)(c2cc(Cl)ccc12)c1ccc(CN2CCCC2)cc1OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: