| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 12 |
|---|
| Ligand | BDBM50345306 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_752183 (CHEMBL1786559) |
|---|
| IC50 | 300±n/a nM |
|---|
| Citation |  Bach, P; Boström, J; Brickmann, K; van Giezen, JJ; Hovland, R; Petersson, AU; Ray, A; Zetterberg, F A novel series of piperazinyl-pyridine ureas as antagonists of the purinergic P2Y12 receptor. Bioorg Med Chem Lett21:2877-81 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 12 |
|---|
| Name: | P2Y purinoceptor 12 |
|---|
| Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39458.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H244 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
|---|
| BDBM50345306 |
|---|
| n/a |
|---|
| Name | BDBM50345306 |
|---|
| Synonyms: | CHEMBL1784193 | Ethyl 6-(4-{[(4-chlorophenyl)amino]carbonyl}piperazin-1-yl)-5-cyano-2-(trifluoro-methyl)nicotinate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19ClF3N5O3 |
|---|
| Mol. Mass. | 481.855 |
|---|
| SMILES | CCOC(=O)c1cc(C#N)c(nc1C(F)(F)F)N1CCN(CC1)C(=O)Nc1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
