Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50345326
Substrate/Competitorn/a
Meas. Tech.ChEMBL_752183
IC50 100±n/a nM
Citation Bach PBoström JBrickmann Kvan Giezen JJHovland RPetersson AURay AZetterberg F A novel series of piperazinyl-pyridine ureas as antagonists of the purinergic P2Y12 receptor. Bioorg Med Chem Lett 21:2877-81 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345326
n/a
NameBDBM50345326
Synonyms:CHEMBL1784212 | Ethyl 5-chloro-6-{4-[(1-naphthylamino)carbonyl]piperazin-1-yl}nicotinate
TypeSmall organic molecule
Emp. Form.C23H23ClN4O3
Mol. Mass.438.907
SMILESCCOC(=O)c1cnc(N2CCN(CC2)C(=O)Nc2cccc3ccccc23)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: