Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
LigandBDBM50345537
Substrate/Competitorn/a
Meas. Tech.ChEMBL_751100
IC50 1.2±n/a nM
Citation De Savi CPape ASawyer YMilne DDavies CCumming JGTing ALamont SSmith PDTart JPage KMoore P Orally active achiral N-hydroxyformamide inhibitors of ADAM-TS4 (aggrecanase-1) and ADAM-TS5 (aggrecanase-2) for the treatment of osteoarthritis. Bioorg Med Chem Lett 21:3301-6 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Synonyms:Aggrecanase-1 | Metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Type:Enzyme
Mol. Mass.:90214.54
Organism:Homo sapiens (Human)
Description:O75173
Residue:837
Sequence:
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345537
n/a
NameBDBM50345537
Synonyms:CHEMBL1784369 | N-(4-((4-(4-chloro-2-methylphenethyl)piperidin-1-ylsulfonyl)methyl)-1-(cyclobutanecarbonyl)piperidin-4-yl)-N-hydroxyformamide
TypeSmall organic molecule
Emp. Form.C26H38ClN3O5S
Mol. Mass.540.115
SMILESCc1cc(Cl)ccc1CCC1CCN(CC1)S(=O)(=O)CC1(CCN(CC1)C(=O)C1CCC1)N(O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: