Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50346330 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_749289 (CHEMBL1785224) |
---|
IC50 | 0.32±n/a nM |
---|
Citation | Ballet, S; Feytens, D; Buysse, K; Chung, NN; Lemieux, C; Tumati, S; Keresztes, A; Van Duppen, J; Lai, J; Varga, E; Porreca, F; Schiller, PW; Vanden Broeck, J; Tourwé, D Design of novel neurokinin 1 receptor antagonists based on conformationally constrained aromatic amino acids and discovery of a potent chimeric opioid agonist-neurokinin 1 receptor antagonist. J Med Chem54:2467-76 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50346330 |
---|
n/a |
---|
Name | BDBM50346330 |
Synonyms: | (R)-N-((S)-2-(2-amino-2-oxoethyl)-3-oxo-2,3,4,5-tetrahydro-1H-benzo[c]azepin-4-yl)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanamido)-5-guanidinopentanamide | CHEMBL1782140 |
Type | Small organic molecule |
Emp. Form. | C29H40N8O5 |
Mol. Mass. | 580.6785 |
SMILES | [#6]-c1cc(-[#8])cc(-[#6])c1-[#6]-[#6@H](-[#7])-[#6](=O)-[#7]-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@H]-1-[#6]-c2ccccc2-[#6]-[#7](-[#6]-[#6](-[#7])=O)-[#6]-1=O |r| |
Structure |
|