| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50346472 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_751947 (CHEMBL1785789) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Sunnam, SK; Rack, E; Schepmann, D; Wünsch, B Synthesis of 7,9-diazabicyclo[4.2.2]decanes as conformationally restricted κ receptor agonists: fine tuning of the dihedral angle of the ethylenediamine pharmacophore. Eur J Med Chem46:1972-82 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50346472 |
|---|
| n/a |
|---|
| Name | BDBM50346472 |
|---|
| Synonyms: | CHEMBL1782985 | rel-(1RS,2RS,6SR)-methyl9-[2-(3,4-Dichlorophenyl)acetyl]-2-(pyrrolidin-1-yl)-7,9-diaza-bicyclo[4.2.2]decane-7-carboxylate | rel-(1RS,2SR,6SR)-methyl9-[2-(3,4-Dichlorophenyl)acetyl]-2-(pyrrolidin-1-yl)-7,9-diaza-bicyclo[4.2.2]decane-7-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H29Cl2N3O3 |
|---|
| Mol. Mass. | 454.39 |
|---|
| SMILES | COC(=O)N1CC2C(CCCC1CN2C(=O)Cc1ccc(Cl)c(Cl)c1)N1CCCC1 |TLB:2:4:13.12:7.8.9.10,THB:25:7:13.12:4.5| |
|---|
| Structure | 
|
|---|
Search and Browse
