Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50346475 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_751949 (CHEMBL1785791) |
---|
Ki | 531±n/a nM |
---|
Citation | Sunnam, SK; Rack, E; Schepmann, D; Wünsch, B Synthesis of 7,9-diazabicyclo[4.2.2]decanes as conformationally restricted κ receptor agonists: fine tuning of the dihedral angle of the ethylenediamine pharmacophore. Eur J Med Chem46:1972-82 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50346475 |
---|
n/a |
---|
Name | BDBM50346475 |
Synonyms: | CHEMBL1782986 | rel-(1RS,2RS,6SR)-7-benzyl-9-(4-methoxybenzyl)-2-(pyrrolidin-1-yl)-7,9-diazabicyclo-[4.2.2]decane | rel-(1RS,2SR,6SR)-7-benzyl-9-(4-methoxybenzyl)-2-(pyrrolidin-1-yl)-7,9-diazabicyclo-[4.2.2]decane |
Type | Small organic molecule |
Emp. Form. | C27H37N3O |
Mol. Mass. | 419.6022 |
SMILES | COc1ccc(CN2CC3CCCC(C2CN3Cc2ccccc2)N2CCCC2)cc1 |TLB:24:13:7.8:16.15,THB:17:16:7.8:13.12.11.10| |
Structure |
|