| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50346473 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_751949 (CHEMBL1785791) |
|---|
| Ki | 221±n/a nM |
|---|
| Citation |  Sunnam, SK; Rack, E; Schepmann, D; Wünsch, B Synthesis of 7,9-diazabicyclo[4.2.2]decanes as conformationally restricted κ receptor agonists: fine tuning of the dihedral angle of the ethylenediamine pharmacophore. Eur J Med Chem46:1972-82 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50346473 |
|---|
| n/a |
|---|
| Name | BDBM50346473 |
|---|
| Synonyms: | CHEMBL1782987 | rel-(1RS,2RS,6SR)-7-benzyl-9-[2-(3,4-dichlorophenyl)acetyl]-2-(pyrrolidin-1-yl)-7,9-diaza-bicyclo[4.2.2]decane | rel-(1RS,2SR,6SR)-7-benzyl-9-[2-(3,4-dichlorophenyl)acetyl]-2-(pyrrolidin-1-yl)-7,9-diazabicyclo[4.2.2]decane |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H33Cl2N3O |
|---|
| Mol. Mass. | 486.476 |
|---|
| SMILES | Clc1ccc(CC(=O)N2CC3CCCC(C2CN3Cc2ccccc2)N2CCCC2)cc1Cl |TLB:25:14:8.9:17.16,THB:18:17:8.9:14.13.12.11| |
|---|
| Structure | 
|
|---|
Search and Browse
