Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50346477
Substrate/Competitorn/a
Meas. Tech.ChEMBL_751946
Ki 73±n/a nM
Citation Sunnam SKRack ESchepmann DWünsch B Synthesis of 7,9-diazabicyclo[4.2.2]decanes as conformationally restricted κ receptor agonists: fine tuning of the dihedral angle of the ethylenediamine pharmacophore. Eur J Med Chem 46:1972-82 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346477
n/a
NameBDBM50346477
Synonyms:CHEMBL1782989 | endo-2-(3,4-dichlorophenyl)-1-(6-(pyrrolidin-1-yl)-1,4-diazabicyclo[3.3.1]nonan-4-yl)ethanone
TypeSmall organic molecule
Emp. Form.C19H25Cl2N3O
Mol. Mass.382.327
SMILESClc1ccc(CC(=O)N2CCN3CC[C@@H]([C@H]2C3)N2CCCC2)cc1Cl |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: