Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 [K65Q] |
---|
Ligand | BDBM50049730 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_753266 (CHEMBL1799477) |
---|
IC50 | 170±n/a nM |
---|
Citation | Ottanà, R; Maccari, R; Giglio, M; Del Corso, A; Cappiello, M; Mura, U; Cosconati, S; Marinelli, L; Novellino, E; Sartini, S; La Motta, C; Da Settimo, F Identification of 5-arylidene-4-thiazolidinone derivatives endowed with dual activity as aldose reductase inhibitors and antioxidant agents for the treatment of diabetic complications. Eur J Med Chem46:2797-806 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 [K65Q] |
---|
Name: | Aldo-keto reductase family 1 member B1 [K65Q] |
Synonyms: | AKR1B1 | ALDR_BOVIN | Aldose reductase |
Type: | Protein |
Mol. Mass.: | 35916.27 |
Organism: | Bos taurus (Cattle) |
Description: | P16116[K65Q] |
Residue: | 315 |
Sequence: | AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
|
|
|
BDBM50049730 |
---|
n/a |
---|
Name | BDBM50049730 |
Synonyms: | 2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid | CHEMBL56337 | Epalrestat | {5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid |
Type | Small organic molecule |
Emp. Form. | C15H13NO3S2 |
Mol. Mass. | 319.399 |
SMILES | C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 |
Structure |
|