Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Lysine Demethylase
LigandBDBM50009001
Substrate/Competitorn/a
Meas. Tech.ChEMBL_754089
Ki 4330±n/a nM
Citation Lohse BKristensen JLKristensen LHAgger KHelin KGajhede MClausen RP Inhibitors of histone demethylases. Bioorg Med Chem 19:3625-36 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone Lysine Demethylase
Name:Histone Lysine Demethylase
Synonyms:2-OG-Dependent Histone Demethylase JMJD2E | Jumonji domain-containing protein 2E (JMJD2E) | KDM4D-like protein | Lysine-specific demethylase 4D-like | Lysine-specific demethylase 4E | Lysine-specific demethylase 4E (KDM4E)
Type:Enzyme
Mol. Mass.:56815.71
Organism:Homo sapiens (Human)
Description:B2RXH2
Residue:506
Sequence:
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009001
n/a
NameBDBM50009001
Synonyms:5,6,7-Trihydroxyflavone | 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one | Baicalein | Baicalein, 14 | Baicalein, 8 | CHEMBL8260 | US10252984, Table 2.33
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1cc2oc(cc(=O)c2c(O)c1O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: