Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 2
LigandBDBM50346918
Substrate/Competitorn/a
Meas. Tech.ChEMBL_752884
IC50>10000±n/a nM
Citation Devadas BSelness SRXing LMadsen HMMarrufo LDShieh HMessing DMYang JZMorgan HMAnderson GDWebb EGZhang JDevraj RVMonahan JB Substituted N-aryl-6-pyrimidinones: a new class of potent, selective, and orally active p38 MAP kinase inhibitors. Bioorg Med Chem Lett 21:3856-60 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 2
Name:MAP kinase-activated protein kinase 2
Synonyms:MAP kinase-activated protein kinase 2 (MAPKAPK2) | MAP kinase-activated protein kinase 2 (MK2) | MAP kinase-activated protein kinase 2 (p38/MK2) | MAPK-Activated Protein Kinase 2 (MK2) | MAPK-activated protein kinase 2 | MAPKAP kinase 2 | MAPKAPK-2 | MAPKAPK2 | MK2
Type:Serine/threonine-protein kinase
Mol. Mass.:45579.87
Organism:Homo sapiens (Human)
Description:P49137
Residue:400
Sequence:
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346918
n/a
NameBDBM50346918
Synonyms:CHEMBL1738710
TypeSmall organic molecule
Emp. Form.C21H18ClF2N3O4
Mol. Mass.449.835
SMILESCc1ccc(cc1-n1cnc(OCc2ccc(F)cc2F)c(Cl)c1=O)C(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: