Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase p38
LigandBDBM50346920
Substrate/Competitorn/a
Meas. Tech.ChEMBL_752892
Ki 6±n/a nM
Citation Devadas BSelness SRXing LMadsen HMMarrufo LDShieh HMessing DMYang JZMorgan HMAnderson GDWebb EGZhang JDevraj RVMonahan JB Substituted N-aryl-6-pyrimidinones: a new class of potent, selective, and orally active p38 MAP kinase inhibitors. Bioorg Med Chem Lett 21:3856-60 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase p38
Name:MAP kinase p38
Synonyms:MAP kinase p38 | Mitogen-activated protein kinase 11 | Mitogen-activated protein kinase p38 beta | Stress-activated protein kinase 2 | p38-2 | p38-beta | p38b
Type:Enzyme Catalytic Domain
Mol. Mass.:41351.73
Organism:Homo sapiens (Human)
Description:gi_20128774
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346920
n/a
NameBDBM50346920
Synonyms:CHEMBL1795686
TypeSmall organic molecule
Emp. Form.C23H23F2N3O4
Mol. Mass.443.4432
SMILESCCc1c(OCc2ccc(F)cc2F)ncn(-c2cc(ccc2C)C(=O)NCCO)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: